How to read specific lines from a text file and store them in an array?
1 visualizzazione (ultimi 30 giorni)
Mostra commenti meno recenti
I have a text file containing an Multiple Sequence Alignment (MSA) which has protein sequences stored in it. The contents of the file is like this:
>gi|73961569|ref|XP_547536.2| osteocalcin [C. lupus familiaris] MRSLMVLALLAVAALCLCLAGPADAKPSSAESRKGGATFVSKREGSEVVRRLRRYLDSGL GAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV-
>gi|27806301|ref|NP_776674.1| osteocalcin preproprotein
MRTPMLLALLALAT--LCLAGRADAKPGDAESGK-GAAFVSKQEGSEVVKRLRRYLDHWL GAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV-
From this file I just want to extract the lines containing the actual sequences (ones NOT starting with '>' symbol) and store them in an array for future use. One thing to mention is that line 2 and line 3 is one single sequence, so I also need to make them a single string and store it in one single position of an array. How can I do that?
I wanted to use 'fileread' but it reads all the file at a time, so it's not helpful.
1 Commento
Risposte (0)
Vedere anche
Categorie
Scopri di più su Text Files in Help Center e File Exchange
Community Treasure Hunt
Find the treasures in MATLAB Central and discover how the community can help you!
Start Hunting!