Risposto
How to do numerical multiple integral (more than triple) by using matlab?
You can eliminate the variables one by one until you feel comfortable. You can make down to 3 or 2 or 1 variable before final in...

quasi 10 anni fa | 1

Risposto
Matlab Triple Integration Error. Thank You
Replace out2 by out2 = integral3(yi, 0, Inf , 0, @(u3) u3 , 0, @(u3,u2) u2) If you want to use function handles as the ...

quasi 10 anni fa | 1

| accettato

Risposto
Randomly create lower and upper of matrix separately.
l = tril(rand(m,n),-1); % lower triangle u = triu(rand(m,n),1); % upper triangle d = diag(rand(1,m),0); % diagonal eleme...

quasi 10 anni fa | 2

| accettato

Risposto
How to rotate cube in MATLAB.?
Add the following lines of code at the bottom of your code: roll = -0.3064; pitch = -1.2258; yaw = 9.8066; dcm = angle2d...

quasi 10 anni fa | 2

| accettato

Risposto
How can i change values for my data in plot axis?
Replace t in plot by t/3600, that converts t from second to hour Add a text command with appropriate coordinate of the locati...

quasi 10 anni fa | 2

| accettato

Risposto
comparing matrix elements in order
A = [2000 500 300 300 1]'; A1 = sort(A,'descend'); if sum(A==A1)==length(A) disp('in order') else disp('not in...

quasi 10 anni fa | 2

| accettato

Risolto

Make one big string out of two smaller strings
If you have two small strings, like 'a' and 'b', return them put together like 'ab'. 'a' and 'b' => 'ab' For extra ...

quasi 10 anni fa

Risolto

Determine whether a vector is monotonically increasing
Return true if the elements of the input vector increase monotonically (i.e. each element is larger than the previous). Return f...

quasi 10 anni fa

Risposto
the number of occurences of each character of one string,in another
s = 'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVP...

quasi 10 anni fa | 1

Risposto
Constructing an approximate periodical function x(t) giving its Fourier series coefficient?
You can use a vectorized code to get the periodic signal: f0 = 1; % set the frequency of desired signal t = 0:0.01:8; ...

quasi 10 anni fa | 1

Risposto
Confusion Matrix Results Issue
The input arguments of confusion, (in this case, outputs and predictedOutput) should be in range of [0 1]. So, instead of 100 an...

quasi 10 anni fa | 1

| accettato

Risposto
how to sparse represent a image?
Convert a to double first, and the use that in sparse. Make sure that a is not in 3D, if so, then make it 2D before using in spa...

quasi 10 anni fa | 2

| accettato

Risposto
error with gmail sending
Make sure you are using some lines of code before using sendmail function: UserName = 'yourmail@gmail.com'; passWord = '...

quasi 10 anni fa | 2

Risposto
matrix operaions sums multiplications
It seems that A(:,3:end) are never used. If that is the case, then you can simply use a for loop: for k = 1:size(B,1) ...

quasi 10 anni fa | 1

Risposto
Selection of priority data
data=[3;4;8;NaN;NaN;NaN;7;4;3;NaN;NaN;2;3;NaN;9]; findNaN = find(isnan(data)); first = findNaN(1); numb...

quasi 10 anni fa | 1

| accettato

Risposto
selecting the last 60 rows in a matrix with an uncertain number of rows
last60rows = a(end-59:end,:)

quasi 10 anni fa | 2

| accettato

Risposto
I wanna define function which has flexible number of argument.
function out = F(varargin) % do stuffs % y = varargin{1}+varargin{2} % out = y+1; etc. For flexible number of...

quasi 10 anni fa | 1

| accettato

Risposto
Element to element Array Multiplication with all answers.
c = bsxfun(@times,a,B1) out = sum(c,2)

quasi 10 anni fa | 1

| accettato

Risposto
GUI I want to take datas from a struct into my listbox
There are multiple ways to do so. One of them: I assume you have a pushbutton to display in the names in the listbox. And if so,...

quasi 10 anni fa | 1

| accettato

Risposto
How to get only those output values which lie under a given curve!
Perhaps, you unconsciously mistyped the x coordinate of third point. I use 3800 instead of 2100, but use what the actual value i...

quasi 10 anni fa | 1

| accettato

Risposto
find power of signal
In time domain: for discrete signal x(n) Instantaneous power = |x(n)|^2 Average power = (1/N) * sum(|x(n)|.^2) N = data...

quasi 10 anni fa | 2

| accettato

Risposto
Image types and matrix multiplication
I guess I=Lena? And, T = load('Wav.mat'); % the .mat file you uploaded T1 = T.T1; ? If yes, then replace inverse ...

quasi 10 anni fa | 1

Risposto
Cumnwise multiplication between a matrix and a vector.
A = [1 2 3; 7 2 4; 2 0 4] B = [1 2 3] C = bsxfun(@times,A,B)

quasi 10 anni fa | 1

| accettato

Risposto
How to concatenate string vectors of unequal length?
v1 = {'a' 'b' 'c'}'; v2 = {'d'}'; v3 = {'e' 'f'}'; Lv1 = length(v1); Lv2 = length(v2); Lv3 = length(v3); n = max([...

quasi 10 anni fa | 1

Risposto
How to clear data from plot in matlab GUI, but then re-plot it without re-running the GUI
Use cla under the Callback function of your button. Don't use *clear all* command, as it clears all variables. Examples: cl...

quasi 10 anni fa | 2

Risposto
I have a circuit that I want to gain its transfer function.I've attached a JPG file.
Input voltage (across left C) = Vi Output voltage (across right C) = Vo Apply voltage divider rule in RL and C (at right) ...

quasi 10 anni fa | 1

| accettato

Risposto
Finding peaks in data based on certain threshold
Once I had to write a function for this type of problem in on of my projects. Seeing your question here, I have uploaded that fi...

quasi 10 anni fa | 2

| accettato

Risposto
How can I substitute a variable?
a= 5; syms x y = a*sin(x).^2 ./(sin(x) + cos(x)); subs ( y,{x},{2} )

quasi 10 anni fa | 1

Risposto
Count the index of the array
A=[0 0 0 0 0 0 0 0 0 10 0 0 0 0 15 0 17]; sum(A>0)

quasi 10 anni fa | 2

Risposto
integration of FFT
K_fourier is double type in your code. int cannot take double type as the function. @ Thorsten: int performs all symbolic, de...

quasi 10 anni fa | 1